PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_5831_iso_7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 405aa    MW: 46154 Da    PI: 5.833
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_5831_iso_7genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.56.2e-13109150446
                                          S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                      Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                          W ++E+ ll+++++++G g+W+ +a+++g +++  qc++++++
  cra_locus_5831_iso_7_len_1728_ver_3 109 WNADEEILLLEGIEMYGLGNWAEVAEHVG-TKSKSQCIDHYNT 150
                                          *****************************.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0250242.8E-12336405IPR016827Transcriptional adaptor 2
SMARTSM002911.3E-94590IPR000433Zinc finger, ZZ-type
PfamPF005695.6E-104790IPR000433Zinc finger, ZZ-type
PROSITE profilePS5013510.9144992IPR000433Zinc finger, ZZ-type
SuperFamilySSF578508.0E-1449112No hitNo description
CDDcd023351.09E-244997No hitNo description
PROSITE patternPS0135705178IPR000433Zinc finger, ZZ-type
SuperFamilySSF466893.07E-13102156IPR009057Homeodomain-like
PROSITE profilePS5129321.02104156IPR017884SANT domain
SMARTSM007173.4E-12105154IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.9E-10108152IPR009057Homeodomain-like
PfamPF002496.7E-13109150IPR001005SANT/Myb domain
CDDcd001672.22E-12109151No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009409Biological Processresponse to cold
GO:0016573Biological Processhistone acetylation
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MGRSRNVPHP TEEDFGQSRS KRKRTPSTAE TLEAVTAGQD VTDGKKALYH CNYCNKDISG  60
KIRIKCVMCS DFDLCVECFS VGAEVHPHKS NHPYRVMDNL SFPLICADWN ADEEILLLEG  120
IEMYGLGNWA EVAEHVGTKS KSQCIDHYNT IYMNSLCFPL PDMSHVKGKN REELLAMARD  180
HSETKKGFSS PGEANVTEEP PFSARMKVED QKKEGKAESS SRILTSDVAT GPVSGSSNAL  240
TGGAKRTSGI PESKDGCVEV KVEDRSVGEK KPRTSGDEGP SMEEFSGYNS KRQEFEIEYD  300
NDAEQLLADM EFKEADTDAE RELKLRVLRI YSKRLDERKR RKDFILERNL LYPDPFEKQL  360
LPEEKEICRR YRVFMRFHSK EEHENLLLSL VDEHRILKRI QDLQV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1337342RKRRKD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011085400.10.0PREDICTED: transcriptional adapter ADA2-like isoform X1
SwissprotQ75LL61e-174TADA2_ORYSJ; Transcriptional adapter ADA2
TrEMBLA0A068V9T70.0A0A068V9T7_COFCA; Uncharacterized protein
STRINGVIT_12s0057g00920.t010.0(Vitis vinifera)